PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA12227
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Nin-like
Protein Properties Length: 201aa    MW: 23630.1 Da    PI: 8.8756
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA12227genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK80.71.5e-2566114452
                     RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                 ++ +++s+yF++pi +AA+eL+v+lT LK++CR +GI+RWPhRk+ sl
  Tp57577_TGAC_v2_mRNA12227  66 MLTRKTISEYFYMPISQAARELNVGLTHLKKRCRDLGIQRWPHRKLMSL 114
                                6899******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.80350134IPR003035RWP-RK domain
PfamPF020423.5E-2167114IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MWYFENCTIA DFDLYDAKNL LPMGNEVDGG FYAENNVFSI SNNIVENNAK EIMKGKRCRE  60
ENSARMLTRK TISEYFYMPI SQAARELNVG LTHLKKRCRD LGIQRWPHRK LMSLQTLIKN  120
VQEQGDESDE KIRNAVEILQ KEMKKVEEKP DLQLEENTKR LRQACFKANY KKRRLMVMRL  180
MDHQHSSISE IESVNDHIRV *
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013459288.11e-109RWP-RK domain protein
SwissprotQ9M9U92e-51RKD1_ARATH; Protein RKD1
TrEMBLA0A072UU071e-109A0A072UU07_MEDTR; RWP-RK domain protein
STRINGGLYMA04G33516.12e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-52RWP-RK domain-containing protein